PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008243489.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family TCP
Protein Properties Length: 463aa    MW: 50664.7 Da    PI: 6.4203
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008243489.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP54.64.5e-173791458
             TCP  4 kkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpa 58
                     ++r  + h+ v+gR RRvR++++c   +F L++eLG+ +d+ ti+WLl q  p+
  XP_008243489.1 37 ERRRYIDKHSTVNGRHRRVRIPVTCCPGIFRLTQELGHRSDGDTIQWLLSQVRPE 91
                    5678889********************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136912.6464195IPR017887Transcription factor TCP subgroup
PfamPF036341.6E-134391IPR005333Transcription factor, TCP
Gene3DG3DSA:3.60.110.102.8E-64137419IPR003010Carbon-nitrogen hydrolase
SuperFamilySSF563175.36E-61137420IPR003010Carbon-nitrogen hydrolase
PROSITE profilePS5026338.542138442IPR003010Carbon-nitrogen hydrolase
CDDcd075641.00E-107138452No hitNo description
PfamPF007952.1E-53139416IPR003010Carbon-nitrogen hydrolase
PROSITE patternPS009200170185IPR000132Nitrilase/cyanide hydratase, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006807Biological Processnitrogen compound metabolic process
GO:0016810Molecular Functionhydrolase activity, acting on carbon-nitrogen (but not peptide) bonds
Sequence ? help Back to Top
Protein Sequence    Length: 463 aa     Download sequence    Send to blast
MEINQTLPTN TLAITDPPEN PSLQTQPPQQ EEQQQLERRR YIDKHSTVNG RHRRVRIPVT  60
CCPGIFRLTQ ELGHRSDGDT IQWLLSQVRP ELVLPPQPNN RTRRLPPDPV PQPNCRYPGA  120
AEDWLDHKAV ARLPSVTVRA TVVQASTVFF DTPATLDKAE RLVAGAAAYG SQLVVFPEAF  180
VGGYPRGLMF DSATATLSPE EKQAFEKYYA SAIDVPGPEV DRLAKIASKY KVHLVMGVVE  240
RVGFYLCSTV LFFDSFGQCL GKHPKLLPLA SESPVWCSGP KLPVSVYDTE IGRIGGLVCW  300
DNRMPDLRTQ LYGKGIEIYC APTAEAREIW RSSMTHIALE GGCFVLSANQ FCRRKDYPLP  360
LECVSGDSND ATSLDIICAG GSVIVSPSGT ILAGPNYQGE SLISADLDLV EIARAKLEFG  420
GVGLGHNAGP NAVGWRRTSI PNPDLFAATV KTEVSDHANV LYA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3wuy_A1e-3313743115302Nitrilase
3wuy_B1e-3313743115302Nitrilase
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008243489.10.0PREDICTED: bifunctional nitrilase/nitrile hydratase NIT4B-like isoform X1
SwissprotQ429661e-139NRL4B_TOBAC; Bifunctional nitrilase/nitrile hydratase NIT4B
TrEMBLM5WFU80.0M5WFU8_PRUPE; Uncharacterized protein (Fragment)
STRINGPOPTR_0016s07510.11e-144(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF458388
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23280.14e-16TCP family protein